Lineage for d1vi8e_ (1vi8 E:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721630Protein Hypothetical protein YdiI [102910] (1 species)
  7. 721631Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)
  8. 721642Domain d1vi8e_: 1vi8 E: [100746]

Details for d1vi8e_

PDB Entry: 1vi8 (more details), 2.2 Å

PDB Description: crystal structure of a putative thioesterase
PDB Compounds: (E:) Hypothetical protein ydiI

SCOP Domain Sequences for d1vi8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi8e_ d.38.1.5 (E:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
dekgrlccssrlttaile

SCOP Domain Coordinates for d1vi8e_:

Click to download the PDB-style file with coordinates for d1vi8e_.
(The format of our PDB-style files is described here.)

Timeline for d1vi8e_: