Lineage for d1vi8d_ (1vi8 D:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410666Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410667Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 410746Family d.38.1.5: PaaI/YdiI-like [89902] (6 proteins)
  6. 410768Protein Hypothetical protein YdiI [102910] (1 species)
  7. 410769Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)
  8. 410779Domain d1vi8d_: 1vi8 D: [100745]

Details for d1vi8d_

PDB Entry: 1vi8 (more details), 2.2 Å

PDB Description: crystal structure of a putative thioesterase

SCOP Domain Sequences for d1vi8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi8d_ d.38.1.5 (D:) Hypothetical protein YdiI {Escherichia coli}
sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
dekgrlccssrlttaile

SCOP Domain Coordinates for d1vi8d_:

Click to download the PDB-style file with coordinates for d1vi8d_.
(The format of our PDB-style files is described here.)

Timeline for d1vi8d_: