Lineage for d1vi8c1 (1vi8 C:2-136)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943910Protein Hypothetical protein YdiI [102910] (1 species)
  7. 2943911Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)
  8. 2943936Domain d1vi8c1: 1vi8 C:2-136 [100744]
    Other proteins in same PDB: d1vi8a2, d1vi8a3, d1vi8b2, d1vi8b3, d1vi8c2, d1vi8c3, d1vi8d2, d1vi8d3, d1vi8e2, d1vi8e3, d1vi8f2, d1vi8f3, d1vi8g2, d1vi8g3, d1vi8h2, d1vi8h3
    structural genomics

Details for d1vi8c1

PDB Entry: 1vi8 (more details), 2.2 Å

PDB Description: crystal structure of a putative thioesterase
PDB Compounds: (C:) Hypothetical protein ydiI

SCOPe Domain Sequences for d1vi8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi8c1 d.38.1.5 (C:2-136) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
iwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvvl
aesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifde
kgrlccssrlttail

SCOPe Domain Coordinates for d1vi8c1:

Click to download the PDB-style file with coordinates for d1vi8c1.
(The format of our PDB-style files is described here.)

Timeline for d1vi8c1: