SCOP 1.73: Domain d1vi7a2: 1vi7 A:138-208

Lineage for d1vi7a2 (1vi7 A:138-208)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families)

5. Family d.58.11.2: YigZ C-terminal domain-like [102991] (2 proteins)
   similar to EF-G domain V; N-terminal domain shares structural similarity with the EF-G domain IV

6. Protein Hypothetical protein YigZ, C-terminal domain [102992] (1 species)

7. Species Escherichia coli [TaxId:562] [102993] (1 PDB entry)

8. Domain d1vi7a2: 1vi7 A:138-208 [100741]
   Other proteins in same PDB: d1vi7a1
   structural genomics

Details for d1vi7a2

PDB Entry: 1vi7, 2.8 Å

PDB Description: crystal structure of an hypothetical protein

PDB Compounds: (A:) Hypothetical protein yigZ

SCOP Domain Sequences for d1vi7a2:

Sequence; same for both SEQRES and ATOM records:

>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]}
plteytlqceyhqltgieallgqcdgkiinsdyqafvllrvalpaakvaefsakladfsr
gslqllaieee

Timeline for d1vi7a2:

• d1vi7a2 first appeared in SCOP 1.67
  
• d1vi7a2 appears in SCOP 1.71
  
• d1vi7a2 appears in SCOP 1.75
  
• d1vi7a2 appears in the current release, SCOPe 2.08