SCOP 1.75: Domain d1vi7a1: 1vi7 A:3-137

Lineage for d1vi7a1 (1vi7 A:3-137)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.11: YigZ N-terminal domain-like [102772] (2 proteins)
   modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand is inserted between strands 3 and 4

6. Protein Hypothetical protein YigZ, N-terminal domain [102773] (1 species)

7. Species Escherichia coli [TaxId:562] [102774] (1 PDB entry)
   two-domain structure is similar to the C-terminal region of EF-G (domains IV and V)

8. Domain d1vi7a1: 1vi7 A:3-137 [100740]
   Other proteins in same PDB: d1vi7a2
   structural genomics

Details for d1vi7a1

PDB Entry: 1vi7, 2.8 Å

PDB Description: crystal structure of an hypothetical protein

PDB Compounds: (A:) Hypothetical protein yigZ

SCOP Domain Sequences for d1vi7a1:

Sequence; same for both SEQRES and ATOM records:

>d1vi7a1 d.14.1.11 (A:3-137) Hypothetical protein YigZ, N-terminal domain {Escherichia coli [TaxId: 562]}
lmeswlipaapvtvveeikksrfitmlahtdgveaakafvesvraehpdarhhcvawvag
apddsqqlgfsddgepagtagkpmlaqlmgsgvgeitavvvryyggillgtgglvkaygg
gvnqalrqlttqrkt

Timeline for d1vi7a1:

• d1vi7a1 first appeared in SCOP 1.67
  
• d1vi7a1 appears in SCOP 1.73
  
• d1vi7a1 appears in SCOPe 2.01
  
• d1vi7a1 appears in the current release, SCOPe 2.08