Lineage for d1vi7a1 (1vi7 A:3-137)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598471Family d.14.1.11: Hypothetical protein YigZ, N-terminal domain [102772] (1 protein)
    modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand is inserted between strands 3 and 4
  6. 598472Protein Hypothetical protein YigZ, N-terminal domain [102773] (1 species)
  7. 598473Species Escherichia coli [TaxId:562] [102774] (1 PDB entry)
    two-domain structure is similar to the C-terminal region of EF-G (domains IV and V)
  8. 598474Domain d1vi7a1: 1vi7 A:3-137 [100740]
    Other proteins in same PDB: d1vi7a2
    structural genomics

Details for d1vi7a1

PDB Entry: 1vi7 (more details), 2.8 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vi7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi7a1 d.14.1.11 (A:3-137) Hypothetical protein YigZ, N-terminal domain {Escherichia coli}
lmeswlipaapvtvveeikksrfitmlahtdgveaakafvesvraehpdarhhcvawvag
apddsqqlgfsddgepagtagkpmlaqlmgsgvgeitavvvryyggillgtgglvkaygg
gvnqalrqlttqrkt

SCOP Domain Coordinates for d1vi7a1:

Click to download the PDB-style file with coordinates for d1vi7a1.
(The format of our PDB-style files is described here.)

Timeline for d1vi7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi7a2