Lineage for d1vi6c_ (1vi6 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840244Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1840245Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1840246Protein Ribosomal protein S2 [52315] (3 species)
  7. 1840247Species Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries)
  8. 1840250Domain d1vi6c_: 1vi6 C: [100738]
    structural genomics
    complexed with na

Details for d1vi6c_

PDB Entry: 1vi6 (more details), 1.95 Å

PDB Description: crystal structure of ribosomal protein s2p
PDB Compounds: (C:) 30S ribosomal protein S2P

SCOPe Domain Sequences for d1vi6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi6c_ c.23.15.1 (C:) Ribosomal protein S2 {Archaeoglobus fulgidus [TaxId: 2234]}
eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
dftysiedfeaele

SCOPe Domain Coordinates for d1vi6c_:

Click to download the PDB-style file with coordinates for d1vi6c_.
(The format of our PDB-style files is described here.)

Timeline for d1vi6c_: