Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (3 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries) |
Domain d1vi6c_: 1vi6 C: [100738] structural genomics |
PDB Entry: 1vi6 (more details), 1.95 Å
SCOP Domain Sequences for d1vi6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi6c_ c.23.15.1 (C:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq dftysiedfeaele
Timeline for d1vi6c_: