Lineage for d1vi6c1 (1vi6 C:5-197)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. Protein Ribosomal protein S2 [52315] (3 species)
  7. Species Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries)
  8. Domain d1vi6c1: 1vi6 C:5-197 [100738]
    Other proteins in same PDB: d1vi6c2
    structural genomics
    complexed with na

Details for d1vi6c1

PDB Entry: 1vi6 (more details), 1.95 Å

PDB Description: crystal structure of ribosomal protein s2p
PDB Compounds: (C:) 30S ribosomal protein S2P

SCOPe Domain Sequences for d1vi6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi6c1 c.23.15.1 (C:5-197) Ribosomal protein S2 {Archaeoglobus fulgidus [TaxId: 2234]}
eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
dftysiedfeael

SCOPe Domain Coordinates for d1vi6c1 are not available.

Timeline for d1vi6c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi6c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vi6a_, d1vi6b_, d1vi6d_