Lineage for d1vi6a_ (1vi6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858664Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2858665Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2858666Protein Ribosomal protein S2 [52315] (3 species)
  7. 2858667Species Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries)
  8. 2858668Domain d1vi6a_: 1vi6 A: [100736]
    Other proteins in same PDB: d1vi6c2
    structural genomics
    complexed with na

Details for d1vi6a_

PDB Entry: 1vi6 (more details), 1.95 Å

PDB Description: crystal structure of ribosomal protein s2p
PDB Compounds: (A:) 30S ribosomal protein S2P

SCOPe Domain Sequences for d1vi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeoglobus fulgidus [TaxId: 2234]}
eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
dftysiedfeael

SCOPe Domain Coordinates for d1vi6a_:

Click to download the PDB-style file with coordinates for d1vi6a_.
(The format of our PDB-style files is described here.)

Timeline for d1vi6a_: