Lineage for d1vi5d_ (1vi5 D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391633Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 391634Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 391635Protein Ribosomal protein S2 [52315] (2 species)
  7. 391636Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries)
  8. 391644Domain d1vi5d_: 1vi5 D: [100735]
    structural genomics

Details for d1vi5d_

PDB Entry: 1vi5 (more details), 2.65 Å

PDB Description: crystal structure of ribosomal protein s2p

SCOP Domain Sequences for d1vi5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi5d_ c.23.15.1 (D:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus}
yeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsry
epskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpai
dkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgqd
ftysiedfeael

SCOP Domain Coordinates for d1vi5d_:

Click to download the PDB-style file with coordinates for d1vi5d_.
(The format of our PDB-style files is described here.)

Timeline for d1vi5d_: