SCOP 1.67: Domain d1vi5d_: 1vi5 D:

Lineage for d1vi5d_ (1vi5 D:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family)
   fold elaborated with additional structures

5. Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)

6. Protein Ribosomal protein S2 [52315] (2 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries)

8. Domain d1vi5d_: 1vi5 D: [100735]
   structural genomics

Details for d1vi5d_

PDB Entry: 1vi5, 2.65 Å

PDB Description: crystal structure of ribosomal protein s2p

SCOP Domain Sequences for d1vi5d_:

Sequence; same for both SEQRES and ATOM records:

>d1vi5d_ c.23.15.1 (D:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus}
yeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsry
epskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpai
dkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgqd
ftysiedfeael

Timeline for d1vi5d_:

• d1vi5d_ is new in SCOP 1.67
  
• d1vi5d_ appears in SCOP 1.69
  
• d1vi5d_ appears in the current release, SCOPe 2.08