SCOPe 2.04: Domain d1vi5b_: 1vi5 B:

Lineage for d1vi5b_ (1vi5 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family)
   fold elaborated with additional structures

5. Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)

6. Protein Ribosomal protein S2 [52315] (3 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [102246] (2 PDB entries)

8. Domain d1vi5b_: 1vi5 B: [100733]
   structural genomics

Details for d1vi5b_

PDB Entry: 1vi5, 2.65 Å

PDB Description: crystal structure of ribosomal protein s2p

PDB Compounds: (B:) 30S ribosomal protein S2P

SCOPe Domain Sequences for d1vi5b_:

Sequence; same for both SEQRES and ATOM records:

>d1vi5b_ c.23.15.1 (B:) Ribosomal protein S2 {Archaeoglobus fulgidus [TaxId: 2234]}
keyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakfls
ryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndp
aidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirg
qdftysiedfeaele

Timeline for d1vi5b_:

• d1vi5b_ first appeared in SCOP 1.67
  
• d1vi5b_ appears in SCOPe 2.03
  
• d1vi5b_ appears in SCOPe 2.05
  
• d1vi5b_ appears in the current release, SCOPe 2.08, called d1vi5b1