Lineage for d1vi4a1 (1vi4 A:2-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851428Superfamily c.8.7: RraA-like [89562] (2 families) (S)
    structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase
  5. 2851429Family c.8.7.1: RraA-like [89563] (5 proteins)
    aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
    automatically mapped to Pfam PF03737
  6. 2851443Protein Hypothetical protein VC2366 [102194] (1 species)
    RraA homologue
  7. 2851444Species Vibrio cholerae [TaxId:666] [102195] (1 PDB entry)
  8. 2851445Domain d1vi4a1: 1vi4 A:2-162 [100731]
    Other proteins in same PDB: d1vi4a2
    structural genomics

Details for d1vi4a1

PDB Entry: 1vi4 (more details), 1.87 Å

PDB Description: crystal structure of regulator of ribonuclease activity a protein 1
PDB Compounds: (A:) Regulator of ribonuclease activity A protein 1

SCOPe Domain Sequences for d1vi4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi4a1 c.8.7.1 (A:2-162) Hypothetical protein VC2366 {Vibrio cholerae [TaxId: 666]}
mrditpdlcdkyesqvtllnlplqnfgqrsafwgeivtvrcyhdnskvrdvlsqngkgkv
lvvdghgschkalmgdqlailaikndwegviiygavrdvvamsemdlgikalgtspfkte
krgagqvnvtltmqnqivepgdylyadwngilmsetaldva

SCOPe Domain Coordinates for d1vi4a1:

Click to download the PDB-style file with coordinates for d1vi4a1.
(The format of our PDB-style files is described here.)

Timeline for d1vi4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi4a2