SCOP 1.69: Domain d1vi3a_: 1vi3 A:

Lineage for d1vi3a_ (1vi3 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (2 families)

5. Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)

6. Protein Hypothetical protein YbhB [63702] (1 species)

7. Species Escherichia coli [TaxId:562] [63703] (2 PDB entries)

8. Domain d1vi3a_: 1vi3 A: [100730]
   structural genomics

Details for d1vi3a_

PDB Entry: 1vi3, 1.76 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vi3a_:

Sequence; same for both SEQRES and ATOM records:

>d1vi3a_ b.17.1.2 (A:) Hypothetical protein YbhB {Escherichia coli}
slklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
vhaldieridvdegasgamvgfnvhfhslasasitamfse

Timeline for d1vi3a_:

• d1vi3a_ first appeared in SCOP 1.67
  
• d1vi3a_ appears in SCOP 1.71
  
• d1vi3a_ appears in the current release, SCOPe 2.08, called d1vi3a1