Lineage for d1vi3a_ (1vi3 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370218Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 370219Superfamily b.17.1: PEBP-like [49777] (2 families) (S)
  5. 370237Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)
  6. 370242Protein Hypothetical protein YbhB [63702] (1 species)
  7. 370243Species Escherichia coli [TaxId:562] [63703] (2 PDB entries)
  8. 370245Domain d1vi3a_: 1vi3 A: [100730]
    structural genomics
    complexed with act

Details for d1vi3a_

PDB Entry: 1vi3 (more details), 1.76 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi3a_ b.17.1.2 (A:) Hypothetical protein YbhB {Escherichia coli}
slklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
vhaldieridvdegasgamvgfnvhfhslasasitamfse

SCOP Domain Coordinates for d1vi3a_:

Click to download the PDB-style file with coordinates for d1vi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1vi3a_: