SCOPe 2.07: Domain d1vi3a1: 1vi3 A:2-158

Lineage for d1vi3a1 (1vi3 A:2-158)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 protein domains)
   automatically mapped to Pfam PF01161

6. Protein Hypothetical protein YbhB [63702] (1 species)

7. Species Escherichia coli [TaxId:562] [63703] (2 PDB entries)

8. Domain d1vi3a1: 1vi3 A:2-158 [100730]
   Other proteins in same PDB: d1vi3a2, d1vi3a3
   structural genomics
   complexed with act

Details for d1vi3a1

PDB Entry: 1vi3, 1.76 Å

PDB Description: crystal structure of an hypothetical protein

PDB Compounds: (A:) Protein ybhB

SCOPe Domain Sequences for d1vi3a1:

Sequence; same for both SEQRES and ATOM records:

>d1vi3a1 b.17.1.2 (A:2-158) Hypothetical protein YbhB {Escherichia coli [TaxId: 562]}
klisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgsgw
whwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryiftvh
aldieridvdegasgamvgfnvhfhslasasitamfs

Timeline for d1vi3a1:

• d1vi3a1 first appeared in SCOP 1.67, called d1vi3a_
  
• d1vi3a1 appears in SCOPe 2.06