![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
![]() | Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins) automatically mapped to Pfam PF01161 |
![]() | Protein Hypothetical protein YbhB [63702] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [63703] (2 PDB entries) |
![]() | Domain d1vi3a1: 1vi3 A:2-158 [100730] Other proteins in same PDB: d1vi3a2, d1vi3a3 structural genomics complexed with act |
PDB Entry: 1vi3 (more details), 1.76 Å
SCOPe Domain Sequences for d1vi3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi3a1 b.17.1.2 (A:2-158) Hypothetical protein YbhB {Escherichia coli [TaxId: 562]} klisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgsgw whwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryiftvh aldieridvdegasgamvgfnvhfhslasasitamfs
Timeline for d1vi3a1: