Lineage for d1vi3a1 (1vi3 A:2-158)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369531Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2369532Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2369568Family b.17.1.2: Prokaryotic PEBP-like proteins [63701] (2 proteins)
    automatically mapped to Pfam PF01161
  6. 2369573Protein Hypothetical protein YbhB [63702] (1 species)
  7. 2369574Species Escherichia coli [TaxId:562] [63703] (2 PDB entries)
  8. 2369576Domain d1vi3a1: 1vi3 A:2-158 [100730]
    Other proteins in same PDB: d1vi3a2, d1vi3a3
    structural genomics
    complexed with act

Details for d1vi3a1

PDB Entry: 1vi3 (more details), 1.76 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (A:) Protein ybhB

SCOPe Domain Sequences for d1vi3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi3a1 b.17.1.2 (A:2-158) Hypothetical protein YbhB {Escherichia coli [TaxId: 562]}
klisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgsgw
whwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryiftvh
aldieridvdegasgamvgfnvhfhslasasitamfs

SCOPe Domain Coordinates for d1vi3a1:

Click to download the PDB-style file with coordinates for d1vi3a1.
(The format of our PDB-style files is described here.)

Timeline for d1vi3a1: