Lineage for d1vi2a2 (1vi2 A:5-106)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1376891Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1376892Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1377145Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 1377146Protein Putative shikimate dehydrogenase YdiB [82337] (1 species)
  7. 1377147Species Escherichia coli [TaxId:562] [82338] (3 PDB entries)
  8. 1377148Domain d1vi2a2: 1vi2 A:5-106 [100727]
    Other proteins in same PDB: d1vi2a1, d1vi2b1
    structural genomics
    complexed with nad, so4

Details for d1vi2a2

PDB Entry: 1vi2 (more details), 2.1 Å

PDB Description: Crystal structure of shikimate-5-dehydrogenase with NAD
PDB Compounds: (A:) Shikimate 5-dehydrogenase 2

SCOPe Domain Sequences for d1vi2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}
akyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgt
gvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

SCOPe Domain Coordinates for d1vi2a2:

Click to download the PDB-style file with coordinates for d1vi2a2.
(The format of our PDB-style files is described here.)

Timeline for d1vi2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi2a1