Lineage for d1vi1b_ (1vi1 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401891Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 401892Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 401993Family c.77.1.4: PlsX-like [102660] (1 protein)
    Pfam 02504; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and phosphotransacetylase families
  6. 401994Protein Fatty acid/phospholipid synthesis protein PlsX [102661] (1 species)
  7. 401995Species Bacillus subtilis [TaxId:1423] [102662] (1 PDB entry)
  8. 401997Domain d1vi1b_: 1vi1 B: [100725]
    structural genomics

Details for d1vi1b_

PDB Entry: 1vi1 (more details), 2.95 Å

PDB Description: Crystal structure of a fatty acid/phospholipid synthesis protein

SCOP Domain Sequences for d1vi1b_:

Sequence, based on SEQRES records: (download)

>d1vi1b_ c.77.1.4 (B:) Fatty acid/phospholipid synthesis protein PlsX {Bacillus subtilis}
slriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhad
evieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgid
rpalaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvg
tedkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsa
lsifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgssd
snavfrairqaremvsqnvaaliqeevke

Sequence, based on observed residues (ATOM records): (download)

>d1vi1b_ c.77.1.4 (B:) Fatty acid/phospholipid synthesis protein PlsX {Bacillus subtilis}
slriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhad
evieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgid
rpalaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvg
tedkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsa
lsifkmmrdvmtstltspklkemkmkmeysnyggaslfglkapvikahgssdsnavfrai
rqaremvsqnvaaliqeevke

SCOP Domain Coordinates for d1vi1b_:

Click to download the PDB-style file with coordinates for d1vi1b_.
(The format of our PDB-style files is described here.)

Timeline for d1vi1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vi1a_