Lineage for d1vi1b1 (1vi1 B:2-328)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138924Family c.77.1.4: PlsX-like [102660] (1 protein)
    Pfam PF02504; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and phosphotransacetylase families
  6. 2138925Protein Fatty acid/phospholipid synthesis protein PlsX [102661] (2 species)
  7. 2138926Species Bacillus subtilis [TaxId:1423] [102662] (1 PDB entry)
  8. 2138928Domain d1vi1b1: 1vi1 B:2-328 [100725]
    Other proteins in same PDB: d1vi1a2, d1vi1b2
    structural genomics

Details for d1vi1b1

PDB Entry: 1vi1 (more details), 2.95 Å

PDB Description: Crystal structure of a fatty acid/phospholipid synthesis protein
PDB Compounds: (B:) Fatty acid/phospholipid synthesis protein plsX

SCOPe Domain Sequences for d1vi1b1:

Sequence, based on SEQRES records: (download)

>d1vi1b1 c.77.1.4 (B:2-328) Fatty acid/phospholipid synthesis protein PlsX {Bacillus subtilis [TaxId: 1423]}
riavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhadev
ieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgidrp
alaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvgte
dkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsals
ifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgssdsn
avfrairqaremvsqnvaaliqeevke

Sequence, based on observed residues (ATOM records): (download)

>d1vi1b1 c.77.1.4 (B:2-328) Fatty acid/phospholipid synthesis protein PlsX {Bacillus subtilis [TaxId: 1423]}
riavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhadev
ieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgidrp
alaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvgte
dkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsals
ifkmmrdvmtstltspklkemkmkmeysnyggaslfglkapvikahgssdsnavfrairq
aremvsqnvaaliqeevke

SCOPe Domain Coordinates for d1vi1b1:

Click to download the PDB-style file with coordinates for d1vi1b1.
(The format of our PDB-style files is described here.)

Timeline for d1vi1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi1b2