Lineage for d1vi0b2 (1vi0 B:78-193)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543325Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 543326Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 543327Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 543349Protein Hypothetical transcriptional regulator YsiA [101428] (1 species)
  7. 543350Species Bacillus subtilis [TaxId:1423] [101429] (1 PDB entry)
  8. 543352Domain d1vi0b2: 1vi0 B:78-193 [100723]
    Other proteins in same PDB: d1vi0a1, d1vi0b1
    structural genomics
    complexed with dcc

Details for d1vi0b2

PDB Entry: 1vi0 (more details), 1.65 Å

PDB Description: crystal structure of a transcriptional regulator

SCOP Domain Sequences for d1vi0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi0b2 a.121.1.1 (B:78-193) Hypothetical transcriptional regulator YsiA {Bacillus subtilis}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn

SCOP Domain Coordinates for d1vi0b2:

Click to download the PDB-style file with coordinates for d1vi0b2.
(The format of our PDB-style files is described here.)

Timeline for d1vi0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi0b1