![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Hypothetical transcriptional regulator YsiA [101428] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101429] (1 PDB entry) |
![]() | Domain d1vi0b2: 1vi0 B:78-193 [100723] Other proteins in same PDB: d1vi0a1, d1vi0b1 structural genomics complexed with dcc |
PDB Entry: 1vi0 (more details), 1.65 Å
SCOPe Domain Sequences for d1vi0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi0b2 a.121.1.1 (B:78-193) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn
Timeline for d1vi0b2: