Lineage for d1vi0b2 (1vi0 B:78-193)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. Protein Hypothetical transcriptional regulator YsiA [101428] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [101429] (1 PDB entry)
  8. Domain d1vi0b2: 1vi0 B:78-193 [100723]
    Other proteins in same PDB: d1vi0a1, d1vi0b1
    structural genomics
    complexed with dcc

Details for d1vi0b2

PDB Entry: 1vi0 (more details), 1.6500000000000001 Å

PDB Description: crystal structure of a transcriptional regulator
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d1vi0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi0b2 a.121.1.1 (B:78-193) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn

SCOPe Domain Coordinates for d1vi0b2 are not available.

Timeline for d1vi0b2:

Domains from same chain:
(mouse over for more information)
d1vi0b1
Domains from other chains:
(mouse over for more information)
d1vi0a1, d1vi0a2