Lineage for d1vi0a2 (1vi0 A:78-194)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008192Protein Hypothetical transcriptional regulator YsiA [101428] (1 species)
  7. 2008193Species Bacillus subtilis [TaxId:1423] [101429] (1 PDB entry)
  8. 2008194Domain d1vi0a2: 1vi0 A:78-194 [100721]
    Other proteins in same PDB: d1vi0a1, d1vi0b1
    structural genomics
    complexed with dcc

Details for d1vi0a2

PDB Entry: 1vi0 (more details), 1.65 Å

PDB Description: Crystal structure of a transcriptional regulator
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d1vi0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi0a2 a.121.1.1 (A:78-194) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihnk

SCOPe Domain Coordinates for d1vi0a2:

Click to download the PDB-style file with coordinates for d1vi0a2.
(The format of our PDB-style files is described here.)

Timeline for d1vi0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi0a1