Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein ADP compounds hydrolase NudE [103203] (1 species) |
Species Escherichia coli [TaxId:562] [103204] (2 PDB entries) |
Domain d1vhzb_: 1vhz B: [100719] Other proteins in same PDB: d1vhza2 structural genomics complexed with apr |
PDB Entry: 1vhz (more details), 2.32 Å
SCOPe Domain Sequences for d1vhzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhzb_ d.113.1.1 (B:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk gqgrv
Timeline for d1vhzb_: