Lineage for d1vhza_ (1vhz A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417356Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 417357Superfamily d.113.1: Nudix [55811] (4 families) (S)
  5. 417358Family d.113.1.1: MutT-like [55812] (10 proteins)
  6. 417362Protein ADP compounds hydrolase NudE [103203] (1 species)
  7. 417363Species Escherichia coli [TaxId:562] [103204] (2 PDB entries)
  8. 417364Domain d1vhza_: 1vhz A: [100718]

Details for d1vhza_

PDB Entry: 1vhz (more details), 2.32 Å

PDB Description: crystal structure of adp compounds hydrolase

SCOP Domain Sequences for d1vhza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli}
slskslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddh
lilireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsy
fsskmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrew
lkgqgr

SCOP Domain Coordinates for d1vhza_:

Click to download the PDB-style file with coordinates for d1vhza_.
(The format of our PDB-style files is described here.)

Timeline for d1vhza_: