Lineage for d1vhza1 (1vhz A:2-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971446Protein ADP compounds hydrolase NudE [103203] (1 species)
  7. 2971447Species Escherichia coli [TaxId:562] [103204] (2 PDB entries)
  8. 2971448Domain d1vhza1: 1vhz A:2-185 [100718]
    Other proteins in same PDB: d1vhza2
    structural genomics
    complexed with apr

    has additional subdomain(s) that are not in the common domain

Details for d1vhza1

PDB Entry: 1vhz (more details), 2.32 Å

PDB Description: crystal structure of adp compounds hydrolase
PDB Compounds: (A:) ADP compounds hydrolase nudE

SCOPe Domain Sequences for d1vhza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhza1 d.113.1.1 (A:2-185) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}
skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
gqgr

SCOPe Domain Coordinates for d1vhza1:

Click to download the PDB-style file with coordinates for d1vhza1.
(The format of our PDB-style files is described here.)

Timeline for d1vhza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhza2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vhzb_