SCOPe 2.05: Domain d1vhyb1: 1vhy B:3-73

Lineage for d1vhyb1 (1vhy B:3-73)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.2: YggJ N-terminal domain-like [89451] (3 proteins)

6. Protein Hypothetical protein HI0303 [89452] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89453] (2 PDB entries)

8. Domain d1vhyb1: 1vhy B:3-73 [100716]
   Other proteins in same PDB: d1vhya2, d1vhyb2
   structural genomics

Details for d1vhyb1

PDB Entry: 1vhy, 1.9 Å

PDB Description: crystal structure of haemophilus influenzae protein hi0303, pfam duf558

PDB Compounds: (B:) Hypothetical protein HI0303

SCOPe Domain Sequences for d1vhyb1:

Sequence, based on SEQRES records:

>d1vhyb1 b.122.1.2 (B:3-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
ipriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkksv
kveilgrelad

Sequence, based on observed residues (ATOM records):

>d1vhyb1 b.122.1.2 (B:3-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
ipriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiivkveilg
relad

Timeline for d1vhyb1:

• d1vhyb1 first appeared in SCOP 1.67
  
• d1vhyb1 appears in SCOPe 2.04
  
• d1vhyb1 appears in SCOPe 2.06
  
• d1vhyb1 appears in the current release, SCOPe 2.08