SCOP 1.67: Domain d1vhwf_: 1vhw F:

Lineage for d1vhwf_ (1vhw F:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (7 species)

7. Species Vibrio cholerae [TaxId:666] [102499] (2 PDB entries)

8. Domain d1vhwf_: 1vhw F: [100711]
   structural genomics
   complexed with adn

Details for d1vhwf_

PDB Entry: 1vhw, 1.54 Å

PDB Description: crystal structure of purine nucleoside phosphorylase with adenosine

SCOP Domain Sequences for d1vhwf_:

Sequence, based on SEQRES records:

>d1vhwf_ c.56.2.1 (F:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq

Sequence, based on observed residues (ATOM records):

>d1vhwf_ c.56.2.1 (F:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeqterqntfnemieialdsvligdq

Timeline for d1vhwf_:

• d1vhwf_ is new in SCOP 1.67
  
• d1vhwf_ appears in SCOP 1.69
  
• d1vhwf_ appears in the current release, SCOPe 2.08