Lineage for d1vhwd_ (1vhw D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887952Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2888240Species Vibrio cholerae [TaxId:666] [102499] (2 PDB entries)
  8. 2888244Domain d1vhwd_: 1vhw D: [100709]
    structural genomics
    complexed with adn

Details for d1vhwd_

PDB Entry: 1vhw (more details), 1.54 Å

PDB Description: crystal structure of purine nucleoside phosphorylase with adenosine
PDB Compounds: (D:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1vhwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhwd_ c.56.2.1 (D:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae [TaxId: 666]}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq

SCOPe Domain Coordinates for d1vhwd_:

Click to download the PDB-style file with coordinates for d1vhwd_.
(The format of our PDB-style files is described here.)

Timeline for d1vhwd_: