![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins) |
![]() | Protein Purine nucleoside phosphorylase, PNP [53169] (7 species) |
![]() | Species Vibrio cholerae [TaxId:666] [102499] (2 PDB entries) |
![]() | Domain d1vhwa_: 1vhw A: [100706] |
PDB Entry: 1vhw (more details), 1.54 Å
SCOP Domain Sequences for d1vhwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhwa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae} atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
Timeline for d1vhwa_: