Lineage for d1vhva1 (1vhv A:2-250)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160460Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2160461Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2160462Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2160467Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 2160470Species Archaeoglobus fulgidus [TaxId:2234] [102685] (1 PDB entry)
  8. 2160471Domain d1vhva1: 1vhv A:2-250 [100704]
    Other proteins in same PDB: d1vhva2, d1vhvb2

Details for d1vhva1

PDB Entry: 1vhv (more details), 1.75 Å

PDB Description: crystal structure of diphthine synthase
PDB Compounds: (A:) diphthine synthase

SCOPe Domain Sequences for d1vhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhva1 c.90.1.1 (A:2-250) Diphthine synthase, DphB {Archaeoglobus fulgidus [TaxId: 2234]}
ltfvglglwdvkdisvkgleavreadevyveyytskllssieemeeffgkrvvelersdl
eensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktriihgasistavcglt
glhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepmtighavenliaeda
qmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlaktlhfmefeclrefad
apaelerlv

SCOPe Domain Coordinates for d1vhva1:

Click to download the PDB-style file with coordinates for d1vhva1.
(The format of our PDB-style files is described here.)

Timeline for d1vhva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhva2