Lineage for d1vhva_ (1vhv A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403106Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 403107Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) (S)
  5. 403108Family c.90.1.1: Tetrapyrrole methylase [53791] (3 proteins)
  6. 403113Protein Diphthine synthase [102684] (1 species)
    diphthamide biosynthesis methyltransferase
  7. 403114Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102685] (1 PDB entry)
  8. 403115Domain d1vhva_: 1vhv A: [100704]

Details for d1vhva_

PDB Entry: 1vhv (more details), 1.75 Å

PDB Description: crystal structure of diphthine synthase

SCOP Domain Sequences for d1vhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhva_ c.90.1.1 (A:) Diphthine synthase {Archaeon Archaeoglobus fulgidus}
slltfvglglwdvkdisvkgleavreadevyveyytskllssieemeeffgkrvvelers
dleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktriihgasistavcg
ltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepmtighavenliae
daqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlaktlhfmefeclref
adapaelerlv

SCOP Domain Coordinates for d1vhva_:

Click to download the PDB-style file with coordinates for d1vhva_.
(The format of our PDB-style files is described here.)

Timeline for d1vhva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhvb_