SCOPe 2.04: Domain d1vhua_: 1vhu A:

Lineage for d1vhua_ (1vhu A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (3 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Hypothetical protein AF1521 [89725] (1 species)
   contains extra N-terminal strand

7. Species Archaeoglobus fulgidus [TaxId:2234] [89726] (4 PDB entries)
   Uniprot O28751

8. Domain d1vhua_: 1vhu A: [100703]
   structural genomics
   complexed with mes

Details for d1vhua_

PDB Entry: 1vhu, 1.34 Å

PDB Description: crystal structure of a putative phosphoesterase

PDB Compounds: (A:) hypothetical protein af1521

SCOPe Domain Sequences for d1vhua_:

Sequence; same for both SEQRES and ATOM records:

>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeoglobus fulgidus [TaxId: 2234]}
mevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakacagdaglyte
iskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwseelkeklykaf
lgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkevalviydrks
aevalkvfersl

Timeline for d1vhua_:

• d1vhua_ first appeared in SCOP 1.67
  
• d1vhua_ appears in SCOPe 2.03
  
• d1vhua_ appears in SCOPe 2.05
  
• d1vhua_ appears in the current release, SCOPe 2.08