![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Dephospho-CoA kinase [75187] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [82394] (5 PDB entries) |
![]() | Domain d1vhta1: 1vht A:2-206 [100700] Other proteins in same PDB: d1vhta2, d1vhta3, d1vhtb2, d1vhtb3, d1vhtc2, d1vhtc3 structural genomics complexed with act, ba3 |
PDB Entry: 1vht (more details), 1.59 Å
SCOPe Domain Sequences for d1vhta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhta1 c.37.1.1 (A:2-206) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} ryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaa dgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensly kkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapda iasdvarlhahylqlasqfvsqekp
Timeline for d1vhta1: