Lineage for d1vhsb_ (1vhs B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416835Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 416836Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 416837Family d.108.1.1: N-acetyl transferase, NAT [55730] (18 proteins)
  6. 416941Protein Putative phosphinothricin acetyltransferase YwnH [103171] (1 species)
  7. 416942Species Bacillus subtilis [TaxId:1423] [103172] (1 PDB entry)
  8. 416944Domain d1vhsb_: 1vhs B: [100699]
    structural genomics

Details for d1vhsb_

PDB Entry: 1vhs (more details), 1.8 Å

PDB Description: crystal structure of a putative phosphinothricin n-acetyltransferase

SCOP Domain Sequences for d1vhsb_:

Sequence, based on SEQRES records: (download)

>d1vhsb_ d.108.1.1 (B:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis}
sltlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaeden
gnvaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmaf
ifghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrelse

Sequence, based on observed residues (ATOM records): (download)

>d1vhsb_ d.108.1.1 (B:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis}
sltlrlaehrdleavvaiynstiasepvtpedrmewfsghtesrplyvaedengnvaawi
sfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmafifghnkp
slklfekhgfaewglfpgiaemdgkrydlkilgrelse

SCOP Domain Coordinates for d1vhsb_:

Click to download the PDB-style file with coordinates for d1vhsb_.
(The format of our PDB-style files is described here.)

Timeline for d1vhsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhsa_