Lineage for d1vhsb1 (1vhs B:2-163)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533532Protein Putative phosphinothricin acetyltransferase YwnH [103171] (1 species)
  7. 2533533Species Bacillus subtilis [TaxId:1423] [103172] (1 PDB entry)
  8. 2533535Domain d1vhsb1: 1vhs B:2-163 [100699]
    Other proteins in same PDB: d1vhsa2, d1vhsa3, d1vhsb2, d1vhsb3
    structural genomics

Details for d1vhsb1

PDB Entry: 1vhs (more details), 1.8 Å

PDB Description: crystal structure of a putative phosphinothricin n-acetyltransferase
PDB Compounds: (B:) similar to phosphinothricin acetyltransferase

SCOPe Domain Sequences for d1vhsb1:

Sequence, based on SEQRES records: (download)

>d1vhsb1 d.108.1.1 (B:2-163) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}
tlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaedengn
vaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmafif
ghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrels

Sequence, based on observed residues (ATOM records): (download)

>d1vhsb1 d.108.1.1 (B:2-163) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}
tlrlaehrdleavvaiynstiasepvtpedrmewfsghtesrplyvaedengnvaawisf
etfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmafifghnkpsl
klfekhgfaewglfpgiaemdgkrydlkilgrels

SCOPe Domain Coordinates for d1vhsb1:

Click to download the PDB-style file with coordinates for d1vhsb1.
(The format of our PDB-style files is described here.)

Timeline for d1vhsb1: