Lineage for d1vhqb_ (1vhq B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391660Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 391750Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 391805Protein Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) [89606] (1 species)
    involved in an early stage of isoprenoid biosynthesis; contains a Cys-Glu putative catalytic dyad
  7. 391806Species Escherichia coli [TaxId:562] [89607] (2 PDB entries)
  8. 391808Domain d1vhqb_: 1vhq B: [100697]
    structural genomics
    complexed with act

Details for d1vhqb_

PDB Entry: 1vhq (more details), 1.65 Å

PDB Description: crystal structure of enhancing lycopene biosynthesis protein 2

SCOP Domain Sequences for d1vhqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhqb_ c.23.16.2 (B:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli}
mkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtet
rnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkal
aqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivv
dednkivttpaymlaqniaeaasgidklvsrvlvla

SCOP Domain Coordinates for d1vhqb_:

Click to download the PDB-style file with coordinates for d1vhqb_.
(The format of our PDB-style files is described here.)

Timeline for d1vhqb_:

Domains from other chains:
(mouse over for more information)
d1vhqa_