Lineage for d1vhoa2 (1vho A:3-69,A:153-333)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2126919Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 protein domains)
  6. 2127033Protein Putative endoglucanase TM1048, catalytic domain [102515] (1 species)
    contains insert beta-barrel domain
  7. 2127034Species Thermotoga maritima [TaxId:2336] [102516] (1 PDB entry)
  8. 2127035Domain d1vhoa2: 1vho A:3-69,A:153-333 [100695]
    Other proteins in same PDB: d1vhoa1
    structural genomics
    complexed with cac, so4

Details for d1vhoa2

PDB Entry: 1vho (more details), 1.86 Å

PDB Description: crystal structure of a putative peptidase/endoglucanase
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d1vhoa2:

Sequence, based on SEQRES records: (download)

>d1vhoa2 c.56.5.4 (A:3-69,A:153-333) Putative endoglucanase TM1048, catalytic domain {Thermotoga maritima [TaxId: 2336]}
metgkllmelsnldgpsgyetnvvsyiksviepfvdeakttrhgsligykkgkgigklaf
fahvdeiXidqtafetngkvvgkaldnrascgvlvkvleflkrydhpwdvyvvfsvqeet
gclgaltgayeinpdaaivmdvtfaseppfsdhielgkgpviglgpvvdrnlvqkiieia
kkhnvslqeeavggrsgtetdfvqlvrngvrtslisiplkymhtpvemvdprdveelarl
lslvavele

Sequence, based on observed residues (ATOM records): (download)

>d1vhoa2 c.56.5.4 (A:3-69,A:153-333) Putative endoglucanase TM1048, catalytic domain {Thermotoga maritima [TaxId: 2336]}
metgkllmelsnldgpsgyetnvvsyiksviepfvdeakttrhgsligykkgkgigklaf
fahvdeiXidqtafetngkvvgkaldnrascgvlvkvleflkrydhpwdvyvvfsvqeet
gclgaltgayeinpdaaivmdvtfaseppfsdhielgkgpviglgpvvdrnlvqkiieia
kkhnvslqeeavggrtdfvqlvrngvrtslisiplkymhtpvemvdprdveelarllslv
avele

SCOPe Domain Coordinates for d1vhoa2:

Click to download the PDB-style file with coordinates for d1vhoa2.
(The format of our PDB-style files is described here.)

Timeline for d1vhoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhoa1