Lineage for d1vhoa1 (1vho A:70-152)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671859Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 671860Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 671904Protein Putative endoglucanase TM1048 [101825] (1 species)
  7. 671905Species Thermotoga maritima [TaxId:2336] [101826] (1 PDB entry)
  8. 671906Domain d1vhoa1: 1vho A:70-152 [100694]
    Other proteins in same PDB: d1vhoa2
    structural genomics
    complexed with cac, so4

Details for d1vhoa1

PDB Entry: 1vho (more details), 1.86 Å

PDB Description: crystal structure of a putative peptidase/endoglucanase
PDB Compounds: (A:) endoglucanase

SCOP Domain Sequences for d1vhoa1:

Sequence, based on SEQRES records: (download)

>d1vhoa1 b.49.3.1 (A:70-152) Putative endoglucanase TM1048 {Thermotoga maritima [TaxId: 2336]}
gfvvskvegqfarlepvggvdpkvvyaskvriytkngiergvigmlaphlqdsesrkkvp
tydeifvdlslcergvrvgdiav

Sequence, based on observed residues (ATOM records): (download)

>d1vhoa1 b.49.3.1 (A:70-152) Putative endoglucanase TM1048 {Thermotoga maritima [TaxId: 2336]}
gfvvskvegqfarlepvyaskvriytkngiergvigmlaphlqdsesrkkvptydeifvd
lslcergvrvgdiav

SCOP Domain Coordinates for d1vhoa1:

Click to download the PDB-style file with coordinates for d1vhoa1.
(The format of our PDB-style files is described here.)

Timeline for d1vhoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhoa2