![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) ![]() |
![]() | Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
![]() | Protein Putative endoglucanase TM1048 [101825] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [101826] (1 PDB entry) |
![]() | Domain d1vhoa1: 1vho A:70-152 [100694] Other proteins in same PDB: d1vhoa2 structural genomics complexed with cac, so4 |
PDB Entry: 1vho (more details), 1.86 Å
SCOPe Domain Sequences for d1vhoa1:
Sequence, based on SEQRES records: (download)
>d1vhoa1 b.49.3.1 (A:70-152) Putative endoglucanase TM1048 {Thermotoga maritima [TaxId: 2336]} gfvvskvegqfarlepvggvdpkvvyaskvriytkngiergvigmlaphlqdsesrkkvp tydeifvdlslcergvrvgdiav
>d1vhoa1 b.49.3.1 (A:70-152) Putative endoglucanase TM1048 {Thermotoga maritima [TaxId: 2336]} gfvvskvegqfarlepvyaskvriytkngiergvigmlaphlqdsesrkkvptydeifvd lslcergvrvgdiav
Timeline for d1vhoa1: