SCOPe 2.07: Domain d1vhna1: 1vhn A:5-308

Lineage for d1vhna1 (1vhn A:5-308)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Putative flavin oxidoreducatase TM0096 [102044] (1 species)
   Dihydrouridine synthase (Dus) homologue; contains extra C-terminal alpha-helical domain

7. Species Thermotoga maritima [TaxId:2336] [102045] (1 PDB entry)

8. Domain d1vhna1: 1vhn A:5-308 [100693]
   Other proteins in same PDB: d1vhna2
   structural genomics
   complexed with fmn, so4

Details for d1vhna1

PDB Entry: 1vhn, 1.59 Å

PDB Description: crystal structure of a putative flavin oxidoreductase with flavin

PDB Compounds: (A:) putative flavin oxidoreductase

SCOPe Domain Sequences for d1vhna1:

Sequence; same for both SEQRES and ATOM records:

>d1vhna1 c.1.4.1 (A:5-308) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]}
vkvglapmagytdsafrtlafewgadfafsemvsakgflmnsqkteellpqphernvavq
ifgsepnelseaarilsekykwidlnagcpvrkvvkegaggallkdlrhfryivrelrks
vsgkfsvktrlgwekneveeiyrilveegvdevfihtrtvvqsftgraewkalsvlekri
ptfvsgdiftpedakraleesgcdgllvargaigrpwifkqikdflrsgkysepsreeil
rtferhlelliktkgerkavvemrkflagytkdlkgarrfrekvmkieevqilkemfynf
ikev

Timeline for d1vhna1:

• d1vhna1 first appeared in SCOP 1.67, called d1vhna_
  
• d1vhna1 appears in SCOPe 2.06
  
• d1vhna1 appears in the current release, SCOPe 2.08