SCOP 1.67: Domain d1vhna_: 1vhn A:

Lineage for d1vhna_ (1vhn A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)

6. Protein Putative flavin oxidoreducatase TM0096 [102044] (1 species)
   Dihydrouridine synthase (Dus) homologue; contains extra C-terminal alpha-helical domain

7. Species Thermotoga maritima [TaxId:243274] [102045] (1 PDB entry)

8. Domain d1vhna_: 1vhn A: [100693]
   structural genomics
   complexed with fmn, so4

Details for d1vhna_

PDB Entry: 1vhn, 1.59 Å

PDB Description: crystal structure of a putative flavin oxidoreductase with flavin

SCOP Domain Sequences for d1vhna_:

Sequence; same for both SEQRES and ATOM records:

>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima}
vkvglapmagytdsafrtlafewgadfafsemvsakgflmnsqkteellpqphernvavq
ifgsepnelseaarilsekykwidlnagcpvrkvvkegaggallkdlrhfryivrelrks
vsgkfsvktrlgwekneveeiyrilveegvdevfihtrtvvqsftgraewkalsvlekri
ptfvsgdiftpedakraleesgcdgllvargaigrpwifkqikdflrsgkysepsreeil
rtferhlelliktkgerkavvemrkflagytkdlkgarrfrekvmkieevqilkemfynf
ikeve

Timeline for d1vhna_:

• d1vhna_ is new in SCOP 1.67
  
• d1vhna_ appears in SCOP 1.69
  
• d1vhna_ appears in the current release, SCOPe 2.08, called d1vhna1