Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Putative flavin oxidoreducatase TM0096 [102044] (1 species) Dihydrouridine synthase (Dus) homologue; contains extra C-terminal alpha-helical domain |
Species Thermotoga maritima [TaxId:2336] [102045] (1 PDB entry) |
Domain d1vhna1: 1vhn A:5-308 [100693] Other proteins in same PDB: d1vhna2 structural genomics complexed with fmn, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1vhn (more details), 1.59 Å
SCOPe Domain Sequences for d1vhna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhna1 c.1.4.1 (A:5-308) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} vkvglapmagytdsafrtlafewgadfafsemvsakgflmnsqkteellpqphernvavq ifgsepnelseaarilsekykwidlnagcpvrkvvkegaggallkdlrhfryivrelrks vsgkfsvktrlgwekneveeiyrilveegvdevfihtrtvvqsftgraewkalsvlekri ptfvsgdiftpedakraleesgcdgllvargaigrpwifkqikdflrsgkysepsreeil rtferhlelliktkgerkavvemrkflagytkdlkgarrfrekvmkieevqilkemfynf ikev
Timeline for d1vhna1: