Lineage for d1vhna1 (1vhn A:5-308)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828286Protein Putative flavin oxidoreducatase TM0096 [102044] (1 species)
    Dihydrouridine synthase (Dus) homologue; contains extra C-terminal alpha-helical domain
  7. 2828287Species Thermotoga maritima [TaxId:2336] [102045] (1 PDB entry)
  8. 2828288Domain d1vhna1: 1vhn A:5-308 [100693]
    Other proteins in same PDB: d1vhna2
    structural genomics
    complexed with fmn, so4

    has additional subdomain(s) that are not in the common domain

Details for d1vhna1

PDB Entry: 1vhn (more details), 1.59 Å

PDB Description: crystal structure of a putative flavin oxidoreductase with flavin
PDB Compounds: (A:) putative flavin oxidoreductase

SCOPe Domain Sequences for d1vhna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhna1 c.1.4.1 (A:5-308) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]}
vkvglapmagytdsafrtlafewgadfafsemvsakgflmnsqkteellpqphernvavq
ifgsepnelseaarilsekykwidlnagcpvrkvvkegaggallkdlrhfryivrelrks
vsgkfsvktrlgwekneveeiyrilveegvdevfihtrtvvqsftgraewkalsvlekri
ptfvsgdiftpedakraleesgcdgllvargaigrpwifkqikdflrsgkysepsreeil
rtferhlelliktkgerkavvemrkflagytkdlkgarrfrekvmkieevqilkemfynf
ikev

SCOPe Domain Coordinates for d1vhna1:

Click to download the PDB-style file with coordinates for d1vhna1.
(The format of our PDB-style files is described here.)

Timeline for d1vhna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhna2