Lineage for d1vhmb_ (1vhm B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210555Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2210556Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2210593Protein Hypothetical protein YebR [103182] (1 species)
  7. 2210594Species Escherichia coli [TaxId:562] [103183] (1 PDB entry)
  8. 2210596Domain d1vhmb_: 1vhm B: [100692]
    structural genomics
    complexed with mes

Details for d1vhmb_

PDB Entry: 1vhm (more details), 2.1 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (B:) Protein yebR

SCOPe Domain Sequences for d1vhmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhmb_ d.110.2.1 (B:) Hypothetical protein YebR {Escherichia coli [TaxId: 562]}
mnktefyadlnrdfnalmagetsflatlantsallyerltdinwagfylleddtlvlgpf
qgkiacvripvgrgvcgtavarnqvqriedvhvfdghiacdaasnseivlplvvknqiig
vldidstvfgrftdedeqglrqlvaqlekvlattdykkff

SCOPe Domain Coordinates for d1vhmb_:

Click to download the PDB-style file with coordinates for d1vhmb_.
(The format of our PDB-style files is described here.)

Timeline for d1vhmb_: