Lineage for d1vhma_ (1vhm A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576707Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2576708Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2576745Protein Hypothetical protein YebR [103182] (1 species)
  7. 2576746Species Escherichia coli [TaxId:562] [103183] (1 PDB entry)
  8. 2576747Domain d1vhma_: 1vhm A: [100691]
    structural genomics
    complexed with mes

Details for d1vhma_

PDB Entry: 1vhm (more details), 2.1 Å

PDB Description: crystal structure of an hypothetical protein
PDB Compounds: (A:) Protein yebR

SCOPe Domain Sequences for d1vhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhma_ d.110.2.1 (A:) Hypothetical protein YebR {Escherichia coli [TaxId: 562]}
nktefyadlnrdfnalmagetsflatlantsallyerltdinwagfylleddtlvlgpfq
gkiacvripvgrgvcgtavarnqvqriedvhvfdghiacdaasnseivlplvvknqiigv
ldidstvfgrftdedeqglrqlvaqlekvlattdykkff

SCOPe Domain Coordinates for d1vhma_:

Click to download the PDB-style file with coordinates for d1vhma_.
(The format of our PDB-style files is described here.)

Timeline for d1vhma_: