Lineage for d1vhma_ (1vhm A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417123Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 417165Superfamily d.110.2: GAF domain-like [55781] (2 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 417166Family d.110.2.1: GAF domain [55782] (3 proteins)
  6. 417171Protein Hypothetical protein YebR [103182] (1 species)
  7. 417172Species Escherichia coli [TaxId:562] [103183] (1 PDB entry)
  8. 417173Domain d1vhma_: 1vhm A: [100691]

Details for d1vhma_

PDB Entry: 1vhm (more details), 2.1 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhma_ d.110.2.1 (A:) Hypothetical protein YebR {Escherichia coli}
nktefyadlnrdfnalmagetsflatlantsallyerltdinwagfylleddtlvlgpfq
gkiacvripvgrgvcgtavarnqvqriedvhvfdghiacdaasnseivlplvvknqiigv
ldidstvfgrftdedeqglrqlvaqlekvlattdykkff

SCOP Domain Coordinates for d1vhma_:

Click to download the PDB-style file with coordinates for d1vhma_.
(The format of our PDB-style files is described here.)

Timeline for d1vhma_:

Domains from other chains:
(mouse over for more information)
d1vhmb_