SCOPe 2.08: Domain d1vhma_: 1vhm A:

Lineage for d1vhma_ (1vhm A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein Hypothetical protein YebR [103182] (1 species)

7. Species Escherichia coli [TaxId:562] [103183] (1 PDB entry)

8. Domain d1vhma_: 1vhm A: [100691]
   structural genomics
   complexed with mes

Details for d1vhma_

PDB Entry: 1vhm, 2.1 Å

PDB Description: crystal structure of an hypothetical protein

PDB Compounds: (A:) Protein yebR

SCOPe Domain Sequences for d1vhma_:

Sequence; same for both SEQRES and ATOM records:

>d1vhma_ d.110.2.1 (A:) Hypothetical protein YebR {Escherichia coli [TaxId: 562]}
nktefyadlnrdfnalmagetsflatlantsallyerltdinwagfylleddtlvlgpfq
gkiacvripvgrgvcgtavarnqvqriedvhvfdghiacdaasnseivlplvvknqiigv
ldidstvfgrftdedeqglrqlvaqlekvlattdykkff

Timeline for d1vhma_:

• d1vhma_ first appeared in SCOP 1.67
  
• d1vhma_ appears in SCOPe 2.07