Lineage for d1vhla_ (1vhl A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829512Protein Dephospho-CoA kinase [75187] (3 species)
  7. 829513Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)
  8. 829517Domain d1vhla_: 1vhl A: [100688]
    structural genomics

Details for d1vhla_

PDB Entry: 1vhl (more details), 1.65 Å

PDB Description: crystal structure of dephospho-coa kinase with adenosine-5'- diphosphate
PDB Compounds: (A:) dephospho-coa kinase

SCOP Domain Sequences for d1vhla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhla_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmi
aadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvens
lykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngap
daiasdvarlhahylqlasqfvsqekpe

SCOP Domain Coordinates for d1vhla_:

Click to download the PDB-style file with coordinates for d1vhla_.
(The format of our PDB-style files is described here.)

Timeline for d1vhla_: