SCOPe 2.06: Domain d1vhkc1: 1vhk C:2-73

Lineage for d1vhkc1 (1vhk C:2-73)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.2: YggJ N-terminal domain-like [89451] (3 proteins)

6. Protein Hypothetical protein YqeU [102028] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102029] (1 PDB entry)

8. Domain d1vhkc1: 1vhk C:2-73 [100684]
   Other proteins in same PDB: d1vhka2, d1vhkb2, d1vhkc2, d1vhkd2
   structural genomics; domains of B and D chains are partly disordered

Details for d1vhkc1

PDB Entry: 1vhk, 2.6 Å

PDB Description: crystal structure of an hypothetical protein

PDB Compounds: (C:) Hypothetical protein yqeU

SCOPe Domain Sequences for d1vhkc1:

Sequence; same for both SEQRES and ATOM records:

>d1vhkc1 b.122.1.2 (C:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]}
qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
kvsclviewtne

Timeline for d1vhkc1:

• d1vhkc1 first appeared in SCOP 1.67
  
• d1vhkc1 appears in SCOPe 2.05
  
• d1vhkc1 appears in SCOPe 2.07
  
• d1vhkc1 appears in the current release, SCOPe 2.08