![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (3 families) ![]() |
![]() | Family b.122.1.2: YggJ N-terminal domain-like [89451] (2 proteins) |
![]() | Protein Hypothetical protein YqeU [102028] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102029] (1 PDB entry) |
![]() | Domain d1vhkc1: 1vhk C:2-73 [100684] Other proteins in same PDB: d1vhka2, d1vhkb2, d1vhkc2, d1vhkd2 |
PDB Entry: 1vhk (more details), 2.6 Å
SCOP Domain Sequences for d1vhkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhkc1 b.122.1.2 (C:2-73) Hypothetical protein YqeU {Bacillus subtilis} qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd kvsclviewtne
Timeline for d1vhkc1: