Lineage for d1vhkc1 (1vhk C:2-73)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383312Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 383313Superfamily b.122.1: PUA domain-like [88697] (3 families) (S)
  5. 383337Family b.122.1.2: YggJ N-terminal domain-like [89451] (2 proteins)
  6. 383344Protein Hypothetical protein YqeU [102028] (1 species)
  7. 383345Species Bacillus subtilis [TaxId:1423] [102029] (1 PDB entry)
  8. 383348Domain d1vhkc1: 1vhk C:2-73 [100684]
    Other proteins in same PDB: d1vhka2, d1vhkb2, d1vhkc2, d1vhkd2

Details for d1vhkc1

PDB Entry: 1vhk (more details), 2.6 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vhkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhkc1 b.122.1.2 (C:2-73) Hypothetical protein YqeU {Bacillus subtilis}
qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
kvsclviewtne

SCOP Domain Coordinates for d1vhkc1:

Click to download the PDB-style file with coordinates for d1vhkc1.
(The format of our PDB-style files is described here.)

Timeline for d1vhkc1: