Lineage for d1vhkb2 (1vhk B:74-253)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404674Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 404675Superfamily c.116.1: alpha/beta knot [75217] (5 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 404729Family c.116.1.5: YggJ C-terminal domain-like [89632] (2 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 404736Protein Hypothetical protein YqeU [102281] (1 species)
  7. 404737Species Bacillus subtilis [TaxId:1423] [102282] (1 PDB entry)
  8. 404739Domain d1vhkb2: 1vhk B:74-253 [100683]
    Other proteins in same PDB: d1vhka1, d1vhkb1, d1vhkc1, d1vhkd1

Details for d1vhkb2

PDB Entry: 1vhk (more details), 2.6 Å

PDB Description: crystal structure of an hypothetical protein

SCOP Domain Sequences for d1vhkb2:

Sequence, based on SEQRES records: (download)

>d1vhkb2 c.116.1.5 (B:74-253) Hypothetical protein YqeU {Bacillus subtilis}
nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvklddkkakkkrerwt
kiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeesskqgeisafsaivssl
pkgssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr

Sequence, based on observed residues (ATOM records): (download)

>d1vhkb2 c.116.1.5 (B:74-253) Hypothetical protein YqeU {Bacillus subtilis}
nrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvrerwtkiakeaaeqs
yrnevprvmdvhsfqqllqrmqdfdkcvvayeessafsaivsslpkgssllivfgpeggl
teaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr

SCOP Domain Coordinates for d1vhkb2:

Click to download the PDB-style file with coordinates for d1vhkb2.
(The format of our PDB-style files is described here.)

Timeline for d1vhkb2: